Proteintech, 22220-1-AP, ALDH1B1 Polyclonal antibody

Size: 20ul / 150ul The ALDH1B1 (22220-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1B1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 22220-1-AP targets ALDH1B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse testis tissue, rat brain tissue Positive IHC detected in: human ovary tumor tissue, human colon cancer tissue, human liver tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112). This antibody is specific to ALDH1B1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17557 Product name: Recombinant human ALDH1B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-382 aa of BC001619 Sequence: SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA Predict reactive species Full Name: aldehyde dehydrogenase 1 family, member B1 Calculated Molecular Weight: 517 aa, 57 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC001619 Gene Symbol: ALDH1B1 Gene ID (NCBI): 219 RRID: AB_2879035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.