Proteintech, 22227-1-AP, CEP164 Polyclonal antibody

Size: 20ul / 150ul The CEP164 (22227-1-AP) by Proteintech is a Polyclonal antibody targeting CEP164 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, canine samples 22227-1-AP targets CEP164 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: RPE1 cells Positive IHC detected in: human colon tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, A549 cells, PC-3 cells, MDCK cells, hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CEP164, also called KIAA1052 or NPHP15, is a 1460 amino acid protein containing 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in the G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole. Specification Tested Reactivity: human, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17570 Product name: Recombinant human CEP164 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000602 Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK Predict reactive species Full Name: centrosomal protein 164kDa Calculated Molecular Weight: 1460 aa, 164 kDa Observed Molecular Weight: 164 kDa GenBank Accession Number: BC000602 Gene Symbol: CEP164 Gene ID (NCBI): 22897 RRID: AB_2651175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.