Iright
BRAND / VENDOR: Proteintech

Proteintech, 22240-1-AP, TLR6 Polyclonal antibody

CATALOG NUMBER: 22240-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TLR6 (22240-1-AP) by Proteintech is a Polyclonal antibody targeting TLR6 in WB, ELISA applications with reactivity to human, mouse, rat samples 22240-1-AP targets TLR6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, HT-1080 cells, human brain tissue, Jurkat cells, mouse thymus tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TLR6, also known as CD286, belongs to the Toll-like receptor (TLR) family, which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR6 can form a heterodimer with TLR2. TLR6 and TLR2 are recruited to the macrophage phagosome, where they recognize peptidoglycan, a Gram-positive pathogen component (PMID: 11095740). TLR6 interacts with CD36, following CD36 stimulation by oxLDL or amyloid-beta 42, and forms a heterodimer with TLR4. The trimeric complex is internalized and triggers an inflammatory response. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17686 Product name: Recombinant human TLR6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 143-383 aa of BC111755 Sequence: GNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGPTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLVKLETLI Predict reactive species Full Name: toll-like receptor 6 Calculated Molecular Weight: 480 aa, 56 kDa Observed Molecular Weight: 95-110 kDa GenBank Accession Number: BC111755 Gene Symbol: TLR6 Gene ID (NCBI): 10333 RRID: AB_11232032 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924