Iright
BRAND / VENDOR: Proteintech

Proteintech, 22251-1-AP, FAM98B Polyclonal antibody

CATALOG NUMBER: 22251-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM98B (22251-1-AP) by Proteintech is a Polyclonal antibody targeting FAM98B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22251-1-AP targets FAM98B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Caco-2 cells, Raji cells, mouse brain tissue, rat brain tissue Positive IP detected in: HepG2 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM98B (Family with Sequence Similarity 98 Member B) is a protein-coding gene that has been identified as a component of the human tRNA ligase complex (tRNA-LC), which plays a crucial role in tRNA splicing, RNA repair, and other cellular processes. FAM98B contains a glycine-rich intrinsically disordered region (IDR) that can aggregate, leading to the formation of pathological aggregates associated with neurodegenerative diseases. In a study, FAM98B was found to be depleted in patient tissues with abnormal tRNA splicing intermediates, indicating its role in these diseases. (PMID: 34854379, PMID: 40674500) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17747 Product name: Recombinant human FAM98B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-186 aa of BC093898 Sequence: LEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQ Predict reactive species Full Name: family with sequence similarity 98, member B Calculated Molecular Weight: 330 aa, 37 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC093898 Gene Symbol: FAM98B Gene ID (NCBI): 283742 RRID: AB_2879049 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q52LJ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924