Product Description
Size: 20ul / 150ul
The HOXB4 (22256-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB4 in WB, ELISA applications with reactivity to human samples
22256-1-AP targets HOXB4 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17761 Product name: Recombinant human HOXB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-72 aa of BC049204 Sequence: EYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRDPG Predict reactive species
Full Name: homeobox B4
Calculated Molecular Weight: 251 aa, 28 kDa
Observed Molecular Weight: 28-35 kDa
GenBank Accession Number: BC049204
Gene Symbol: HOXB4
Gene ID (NCBI): 3214
RRID: AB_2879050
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P17483
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924