Iright
BRAND / VENDOR: Proteintech

Proteintech, 22257-1-AP, TSPY3 Polyclonal antibody

CATALOG NUMBER: 22257-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPY3 (22257-1-AP) by Proteintech is a Polyclonal antibody targeting TSPY3 in WB, IHC, ELISA applications with reactivity to human, rat samples 22257-1-AP targets TSPY3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human testis tissue, LNCaP cells Positive IHC detected in: human testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17762 Product name: Recombinant human TSPY3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC075016 Sequence: MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS Predict reactive species Full Name: testis specific protein, Y-linked 3 Calculated Molecular Weight: 308 aa, 35 kDa Observed Molecular Weight: 39-40 kDa GenBank Accession Number: BC075016 Gene Symbol: TSPY3 Gene ID (NCBI): 728137 RRID: AB_11182707 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0CV98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924