Proteintech, 22258-1-AP, ASF1B-specific Polyclonal antibody

Size: 20ul / 150ul The ASF1B-specific (22258-1-AP) by Proteintech is a Polyclonal antibody targeting ASF1B-specific in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 22258-1-AP targets ASF1B-specific in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody specifically reacts with the 19kd ASF1B protein. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17763 Product name: Recombinant human ASF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-202 aa of BC010014 Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI Predict reactive species Full Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae) Calculated Molecular Weight: 202 aa, 22 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC010014 Gene Symbol: ASF1B Gene ID (NCBI): 55723 RRID: AB_2879051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.