Proteintech, 22321-1-AP, PBX2 Polyclonal antibody

Size: 20ul / 150ul The PBX2 (22321-1-AP) by Proteintech is a Polyclonal antibody targeting PBX2 in WB, ELISA applications with reactivity to human samples 22321-1-AP targets PBX2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17766 Product name: Recombinant human PBX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC003111 Sequence: MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDI Predict reactive species Full Name: pre-B-cell leukemia homeobox 2 Calculated Molecular Weight: 430 aa, 46 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC003111 Gene Symbol: PBX2 Gene ID (NCBI): 5089 RRID: AB_2879070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40425 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.