Iright
BRAND / VENDOR: Proteintech

Proteintech, 22324-1-AP, OVGP1 Polyclonal antibody

CATALOG NUMBER: 22324-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OVGP1 (22324-1-AP) by Proteintech is a Polyclonal antibody targeting OVGP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 22324-1-AP targets OVGP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, mouse ovary tissue, mouse uterus tissue Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information OVGP1 (oviduct-specific glycoprotein, also known as MUC9) is a high molecular-weight glycoprotein thought to be exclusively secreted by the non-ciliated epithelial cells of the fallopian tube (PMID: 12444068). Identified first as an estrogen-induced secretory protein in the oviduct, OVGP1 aids in sperm capacitation, fertilization, and early embryonic development (PMID: 28883914). OVGP1 is the major non-serum protein present in OF (oviduct fluid) and its biological activity differs among species (PMID: 27601270). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17771 Product name: Recombinant human OVGP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 329-678 aa of BC126177 Sequence: VGYDNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTDSKILPPGGEAGVTEIHGKCENMTITPRGTTVTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA Predict reactive species Full Name: oviductal glycoprotein 1, 120kDa Calculated Molecular Weight: 678 aa, 75 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC126177 Gene Symbol: OVGP1 Gene ID (NCBI): 5016 RRID: AB_3085696 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q12889 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924