Proteintech, 22336-1-AP, P glycoprotein Polyclonal antibody

Size: 20ul / 150ul The P glycoprotein (22336-1-AP) by Proteintech is a Polyclonal antibody targeting P glycoprotein in WB, IHC, IP, ELISA applications with reactivity to human samples 22336-1-AP targets P glycoprotein in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: unboiled HeLa cells, unboiled HepG2 cells Positive IP detected in: human placenta tissue Positive IHC detected in: human liver cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ABCB1 (also known as P-gp/ P-glycoprotein, MDR1/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection with 22336-1-AP, we recommend to avoid boiling the sample after lysis. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17811 Product name: Recombinant human ABCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 624-708 aa of BC130424 Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW Predict reactive species Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1 Calculated Molecular Weight: 1280 aa, 142 kDa Observed Molecular Weight: 130-150 kDa GenBank Accession Number: BC130424 Gene Symbol: P glycoprotein Gene ID (NCBI): 5243 RRID: AB_2833023 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08183 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.