Proteintech, 22339-1-AP, BTG2 Polyclonal antibody

Size: 20ul / 150ul The BTG2 (22339-1-AP) by Proteintech is a Polyclonal antibody targeting BTG2 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 22339-1-AP targets BTG2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse small intestine tissue, human kidney tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuro-2a cells Positive FC (Intra) detected in: SH-SY5Y cells, Neuro-2a cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Protein BTG2, the anti-proliferative human homolog of murine Pc3/Tis21, belongs to the BTG/Tob family. This family has structurally related proteins that appear to have anti-proliferative properties. It has been demonstrated that BTG2 is p53-inducible and is involved in cell cycle control and cellular response to DNA damage (PMID: 8944033). As a transcriptional co-regulator, BTG2 has been shown to interact with CAF1 and POP2, and works as a co-activator of ERa-mediated transcription via a CCR4-like complex (PMID: 18974182). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17819 Product name: Recombinant human BTG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC105949 Sequence: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY Predict reactive species Full Name: BTG family, member 2 Calculated Molecular Weight: 158 aa, 17 kDa GenBank Accession Number: BC105949 Gene Symbol: BTG2 Gene ID (NCBI): 7832 RRID: AB_2879078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.