Iright
BRAND / VENDOR: Proteintech

Proteintech, 22351-1-AP, CCR3 Polyclonal antibody

CATALOG NUMBER: 22351-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCR3 (22351-1-AP) by Proteintech is a Polyclonal antibody targeting CCR3 in IHC, ELISA applications with reactivity to human samples 22351-1-AP targets CCR3 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17926 Product name: Recombinant human CCR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-354 aa of BC110297 Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV Predict reactive species Full Name: chemokine (C-C motif) receptor 3 Calculated Molecular Weight: 355 aa, 41 kDa GenBank Accession Number: BC110297 Gene Symbol: CCR3 Gene ID (NCBI): 1232 RRID: AB_2879085 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P51677 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924