Proteintech, 22358-1-AP, ALX3 Polyclonal antibody

Size: 20ul / 150ul The ALX3 (22358-1-AP) by Proteintech is a Polyclonal antibody targeting ALX3 in WB, ELISA applications with reactivity to human, mouse samples 22358-1-AP targets ALX3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ALX3 is a transcriptional regulator with a possible role in patterning of mesoderm during development. It is a paired-class aristaless-like homeoprotein expressed in different tissues during embryonic development. We always got 70 kDa dimer form in our detection. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17937 Product name: Recombinant human ALX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC112007 Sequence: MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPYLPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNKSK Predict reactive species Full Name: ALX homeobox 3 Calculated Molecular Weight: 343 aa, 37 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC112007 Gene Symbol: ALX3 Gene ID (NCBI): 257 RRID: AB_2879088 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O95076 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.