Iright
BRAND / VENDOR: Proteintech

Proteintech, 22383-1-AP, LRIG1 Polyclonal antibody

CATALOG NUMBER: 22383-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRIG1 (22383-1-AP) by Proteintech is a Polyclonal antibody targeting LRIG1 in WB, ELISA applications with reactivity to human, mouse samples 22383-1-AP targets LRIG1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LRIG1 acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17880 Product name: Recombinant human LRIG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-397 aa of BC071561 Sequence: CTCAGDSLDCGGRGLAALPGDLPSWTRSLNLSYNKFSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVLDLDHNEISGTIEDTSGAFSGLDSLSKLLLLEPSQSAG Predict reactive species Full Name: leucine-rich repeats and immunoglobulin-like domains 1 Calculated Molecular Weight: 1093 aa, 119 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC071561 Gene Symbol: LRIG1 Gene ID (NCBI): 26018 RRID: AB_2879095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924