Iright
BRAND / VENDOR: Proteintech

Proteintech, 22387-1-AP, ERBB4 Polyclonal antibody

CATALOG NUMBER: 22387-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERBB4 (22387-1-AP) by Proteintech is a Polyclonal antibody targeting ERBB4 in IP, ELISA applications with reactivity to human, mouse samples 22387-1-AP targets ERBB4 in IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse brain tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18002 Product name: Recombinant human ERBB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 989-1308 aa of BC112199 Sequence: GDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV Predict reactive species Full Name: v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) Calculated Molecular Weight: 1308 aa, 147 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC112199 Gene Symbol: ERBB4 Gene ID (NCBI): 2066 RRID: AB_2879096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q15303 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924