Iright
BRAND / VENDOR: Proteintech

Proteintech, 22392-1-AP, IRF7 Polyclonal antibody

CATALOG NUMBER: 22392-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRF7 (22392-1-AP) by Proteintech is a Polyclonal antibody targeting IRF7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 22392-1-AP targets IRF7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information IRF-7 (IFN regulatory factor 7) is a member of the IFN regulatory transcription factor (IRF) family. IRF-7 has been shown to play a role in the transcriptional activation of virus-inducible cellular proteins, including IFN beta chain proteins. Inducible expression of IRF-7 is largely restricted to lymphoid tissue. Four transcript variants encoding distinct isoforms (A,B,C and D) have been identified for this (PMID:9786932).The active IRF7A exists as a dimer form ~80 kDa(PMID:11073981). The MW 67-70 kDa has been reported in some papers (PMID:9786932; 22951831).Various posttranslational modifications of IRF7 including phosphorylation, ubiquitination, sumoylation and acetylation are identified (PMID:22951831).This antibody is a rabbit polyclonal antibody raised against the C-terminal 349 amino acid residues of human IRF7 D. The molecular weight of Nonphosphorylated IRF7 cofractionated with the 44-kDa marker, approximating its predicted size. In contrast, phosphorylated IRF7, which migrate more slowly on SDS-PAGE. This phosphorylated IRF7 was consistent with a size of 80 to 90 kDa. (PMID: 11073981 ) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig, duck, paralichthys olivaceus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18059 Product name: Recombinant human IRF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-516 aa of BC136555 Sequence: PGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA Predict reactive species Full Name: IRF 7 Calculated Molecular Weight: 516 aa, 56 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC136555 Gene Symbol: IRF7 Gene ID (NCBI): 3665 RRID: AB_2879097 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92985 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924