Iright
BRAND / VENDOR: Proteintech

Proteintech, 22419-1-AP, ADRA1B Polyclonal antibody

CATALOG NUMBER: 22419-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADRA1B (22419-1-AP) by Proteintech is a Polyclonal antibody targeting ADRA1B in WB, ELISA applications with reactivity to human, mouse, rat samples 22419-1-AP targets ADRA1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, mouse testis tissue, rat brain tissue Positive FC (Intra) detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18138 Product name: Recombinant human ADRA1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-520 aa of BC136569 Sequence: LGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF Predict reactive species Full Name: adrenergic, alpha-1B-, receptor Calculated Molecular Weight: 520 aa, 57 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC136569 Gene Symbol: ADRA1B Gene ID (NCBI): 147 RRID: AB_2879103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P35368 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924