Iright
BRAND / VENDOR: Proteintech

Proteintech, 22426-1-AP, HNF1A Polyclonal antibody

CATALOG NUMBER: 22426-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HNF1A (22426-1-AP) by Proteintech is a Polyclonal antibody targeting HNF1A in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 22426-1-AP targets HNF1A in WB, IHC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, SMMC-7721 cells, HuH-7 cells Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information HNF-1 , a homoeprotein family designated the Hepatocyte Nuclear Factor family. The various HNF-1 isoforms regulate transcription of genes in the liver as well as in other tissues such as kidney, small intestine and thymus. HNF1 as a transcriptional activator that regulates the tissue specific expression of multiple genes, especially in pancreatic islet cells and in liver. It is required for the expression of several liver specific genes and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18188 Product name: Recombinant human HNF1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-631 aa of BC104910 Sequence: PLHPSYQQPLMPPVQSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ Predict reactive species Full Name: HNF1 homeobox A Calculated Molecular Weight: 631 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC104910 Gene Symbol: HNF1A Gene ID (NCBI): 6927 RRID: AB_2879104 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P20823 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924