Iright
BRAND / VENDOR: Proteintech

Proteintech, 22460-1-AP, NR5A2 Polyclonal antibody

CATALOG NUMBER: 22460-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NR5A2 (22460-1-AP) by Proteintech is a Polyclonal antibody targeting NR5A2 in WB, ELISA applications with reactivity to human, mouse, rat samples 22460-1-AP targets NR5A2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, rat testis tissue, mouse ovary tissue, BxPC-3 cells, mouse liver tissue, mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NR5A2 belongs to the nuclear hormone receptor family NR5 subfamily.It binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation.NR5A2 may be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development. LRH-1 is phosphorylated to display its normal function, including its role in the intriguing potential responses to phospholipid or other ligands. The hinge domain serine residues at 238 and 243 are required for effective phosphorylation, both in vitro and in cells (16439367).NR5A1 is abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in hepG2. Isoform 1 and isoform 2 seem to be present in fetal and adult liver and hepG2 cells.The observed molecular weight of 65-70 kDa is the posphorylation of NR5A2 protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18001 Product name: Recombinant human NR5A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-332 aa of BC118652 Sequence: NGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLL Predict reactive species Full Name: nuclear receptor subfamily 5, group A, member 2 Calculated Molecular Weight: 541 aa, 61 kDa Observed Molecular Weight: 61-67 kDa GenBank Accession Number: BC118652 Gene Symbol: NR5A2 Gene ID (NCBI): 2494 RRID: AB_2879108 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O00482 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924