Proteintech, 22462-1-AP, GNRHR Polyclonal antibody

Size: 20ul / 150ul The GNRHR (22462-1-AP) by Proteintech is a Polyclonal antibody targeting GNRHR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22462-1-AP targets GNRHR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, mouse testis tissue Positive IHC detected in: human testis tissue, rat testis tissue, mouse testis tissue, human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GNRHR, also named GRHR, belongs to the G-protein coupled receptor 1 family. GNRHR is a receptor for GnRH that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). It mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform2 of GNRHR may act as an inhibitor of GnRH-R signaling. Defects in GNRHR are a cause of idiopathic hypogonadotropic hypogonadism (IHH). Defects in GNRHR are a cause of fertile eunuch syndrome. The antibody only recognizes the isoform1 of GNRHR. The predicted unmodified molecular weight of the human GNRHR is ~38 kDa, the larger band (50-65 kDa) is likely to represent a glycosylated form of GNRHR. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18005 Product name: Recombinant human GNRHR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-285 aa of BC113546 Sequence: IMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYV Predict reactive species Full Name: GnRH receptor Calculated Molecular Weight: 328 aa, 38 kDa Observed Molecular Weight: 60 kDa, 50 kDa GenBank Accession Number: BC113546 Gene Symbol: GNRHR Gene ID (NCBI): 2798 RRID: AB_2879109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30968 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.