Iright
BRAND / VENDOR: Proteintech

Proteintech, 22465-1-AP, CDIPT Polyclonal antibody

CATALOG NUMBER: 22465-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDIPT (22465-1-AP) by Proteintech is a Polyclonal antibody targeting CDIPT in IHC, ELISA applications with reactivity to mouse samples 22465-1-AP targets CDIPT in IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18026 Product name: Recombinant human CDIPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-150 aa of BC001444 Sequence: LYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNEL Predict reactive species Full Name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) Calculated Molecular Weight: 213 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001444 Gene Symbol: CDIPT Gene ID (NCBI): 10423 RRID: AB_3085698 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O14735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924