Proteintech, 22471-1-AP, SPDYC Polyclonal antibody

Size: 20ul / 150ul The SPDYC (22471-1-AP) by Proteintech is a Polyclonal antibody targeting SPDYC in IHC, ELISA applications with reactivity to human samples 22471-1-AP targets SPDYC in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissue, human kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SPDYC(Speedy protein C), also known as RINGOC and Ringo2, promotes progression through the cell cycle via binding and activation of CDK1 and CDK2. Downregulation of SPDYC inhibits cell growth, reduces the fraction of cells in G1, and increases the S and G2 populations(PMID: 18802405). SPDYC is involved in the spindle-assembly checkpoint and required for recruitment of MAD2L1, BUBR1 and BUB1 to kinetochores(Uniprot). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18126 Product name: Recombinant human SPDYC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC137244 Sequence: MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH Predict reactive species Full Name: speedy homolog C (Xenopus laevis) Calculated Molecular Weight: 293 aa, 33 kDa Observed Molecular Weight: 33-40 kDa GenBank Accession Number: BC137244 Gene Symbol: SPDYC Gene ID (NCBI): 387778 RRID: AB_3085699 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5MJ68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.