Iright
BRAND / VENDOR: Proteintech

Proteintech, 22582-1-AP, CD268/BAFF-R Polyclonal antibody

CATALOG NUMBER: 22582-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD268/BAFF-R (22582-1-AP) by Proteintech is a Polyclonal antibody targeting CD268/BAFF-R in IHC, ELISA applications with reactivity to human samples 22582-1-AP targets CD268/BAFF-R in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information B-cell-activating factor receptor (BAFF-R, also known as CD268 and TNFRSF13C) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It is expressed in most malignant B cells, including those in primary central nervous system lymphoma (PCNSL), and is involved in the survival and proliferation of these cells (PMID: 32528875). The interaction of BAFF with BAFF-R promotes NF-κB activation, which plays a crucial role in B-cell maturation, survival, and costimulation of T-cell activation and proliferation (PMID: 30349534). Additionally, BAFF-R is associated with chronic kidney disease (CKD) by activating NF-κB signaling in renal tubular epithelial cells (PMID: 38791453). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18202 Product name: Recombinant human TNFRSF13C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC105123 Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 13C Calculated Molecular Weight: 184 aa, 19 kDa GenBank Accession Number: BC105123 Gene Symbol: TNFRSF13C Gene ID (NCBI): 115650 RRID: AB_2879126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96RJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924