Proteintech, 22587-1-AP, WBP2NL Polyclonal antibody

Size: 20ul / 150ul The WBP2NL (22587-1-AP) by Proteintech is a Polyclonal antibody targeting WBP2NL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22587-1-AP targets WBP2NL in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue Positive IHC detected in: mouse testis tissue, mouse ovary tissue, rat epididymis tissue, rat ovary tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WBP2NL, also known as PAWP, is a protein found in the post-acrosomal region of mammalian spermatozoa. It was initially proposed as a sperm-borne oocyte-activating factor (SOAF) that triggers calcium oscillations essential for oocyte activation and embryo development. However, recent studies have shown mixed results regarding its role in fertilization. While some investigations suggest that PAWP can induce oocyte activation, others indicate that it may not be sufficient to compensate for the absence of other critical factors like PLCZ1. Additionally, altered WBP2NL expression has been observed in breast cancer tissues, hinting at its potential involvement in oncogenic regulation. (PMID: 24907910, PMID: 25417742, PMID: 28663133) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18347 Product name: Recombinant human WBP2NL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC022546 Sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS Predict reactive species Full Name: WBP2 N-terminal like Calculated Molecular Weight: 309 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC022546 Gene Symbol: WBP2NL Gene ID (NCBI): 164684 RRID: AB_2879128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ICG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.