Proteintech, 22624-1-AP, PDE5A Polyclonal antibody

Size: 20ul / 150ul The PDE5A (22624-1-AP) by Proteintech is a Polyclonal antibody targeting PDE5A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 22624-1-AP targets PDE5A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IHC detected in: human ovary tumor tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rabbit, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18779 Product name: Recombinant human PDE5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-482 aa of BC126233 Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK Predict reactive species Full Name: phosphodiesterase 5A, cGMP-specific Calculated Molecular Weight: 875 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC126233 Gene Symbol: PDE5A Gene ID (NCBI): 8654 RRID: AB_2879137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76074 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.