Proteintech, 22647-1-AP, A2BP1 Polyclonal antibody

Size: 20ul / 150ul The A2BP1 (22647-1-AP) by Proteintech is a Polyclonal antibody targeting A2BP1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 22647-1-AP targets A2BP1 in WB, IHC, IF-P, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells, mouse liver, mouse brain Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information A2BP1, also named as FOX1 and HRNBP1, contains one RRM (RNA recognition motif) domain. A2BP1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. A2BP1 and ataxin-2 are both localized in the trans-Golgi network. This is a rabbit polyclonal antibody raised against the N terminus of human A2BP1.A2BP1 has two mouse isoforms (A2BP1-A016 and -A030) exogenously expressed in COS7 cells showed a molecular mass of 65 kDa, although the calculated molecular masses of A016 and A030 are 40 and 42 kDa, respectively in the course of cell biological study. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18527 Product name: Recombinant human A2BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC113691 Sequence: MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE Predict reactive species Full Name: ataxin 2-binding protein 1 Calculated Molecular Weight: 395 aa, 42 kDa Observed Molecular Weight: 45-70 kDa GenBank Accession Number: BC113691 Gene Symbol: A2BP1 Gene ID (NCBI): 54715 RRID: AB_2879142 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.