Iright
BRAND / VENDOR: Proteintech

Proteintech, 22649-1-AP, AKIRIN1 Polyclonal antibody

CATALOG NUMBER: 22649-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AKIRIN1 (22649-1-AP) by Proteintech is a Polyclonal antibody targeting AKIRIN1 in IP, ELISA applications with reactivity to human samples 22649-1-AP targets AKIRIN1 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: U-251 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Akirin1 is a highly conserved ubiquitously expressed nuclear protein harboring a clear nuclear localization signal and the protein-protein interaction property. Acting as a cofactor, Akirin1 has been disclosed that regulate transcriptional activities by establishing a link between multiple transcription factors and chromatin remodeling complexes (PMID: 39188701) . Akirin1 has been shown to be involved in the induction of cardiac hypertrophy via miR-1 and serum response factor (SRF) in mice (PMID: 30746755). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18530 Product name: Recombinant human AKIRIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC119745 Sequence: MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQ Predict reactive species Full Name: akirin 1 Calculated Molecular Weight: 192 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC119745 Gene Symbol: AKIRIN1 Gene ID (NCBI): 79647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9L7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924