Proteintech, 22665-1-AP, FSHR Polyclonal antibody

Size: 20ul / 150ul The FSHR (22665-1-AP) by Proteintech is a Polyclonal antibody targeting FSHR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22665-1-AP targets FSHR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, rat ovary tissue, DU 145 cells, PC-3 cells, HeLa cells Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, bovine, sheep, goat, cat, ovis aries (sheep) Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18158 Product name: Recombinant human FSHR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-352 aa of BC118548 Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQTRGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDA Predict reactive species Full Name: follicle stimulating hormone receptor Calculated Molecular Weight: 695 aa, 78 kDa Observed Molecular Weight: 71-78 kDa GenBank Accession Number: BC118548 Gene Symbol: FSHR Gene ID (NCBI): 2492 RRID: AB_2631204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23945 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.