Product Description
Size: 20ul / 150ul
The KDM5D (22739-1-AP) by Proteintech is a Polyclonal antibody targeting KDM5D in WB, ELISA applications with reactivity to human samples
22739-1-AP targets KDM5D in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: TF-1 cells, Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18690 Product name: Recombinant human KDM5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1375-1482 aa of BC146767 Sequence: SRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL Predict reactive species
Full Name: lysine (K)-specific demethylase 5D
Calculated Molecular Weight: 1482 aa, 167 kDa
Observed Molecular Weight: 70 kDa, 175 kDa
GenBank Accession Number: BC146767
Gene Symbol: KDM5D
Gene ID (NCBI): 8284
RRID: AB_2879160
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BY66
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924