Iright
BRAND / VENDOR: Proteintech

Proteintech, 22739-1-AP, KDM5D Polyclonal antibody

CATALOG NUMBER: 22739-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KDM5D (22739-1-AP) by Proteintech is a Polyclonal antibody targeting KDM5D in WB, ELISA applications with reactivity to human samples 22739-1-AP targets KDM5D in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TF-1 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18690 Product name: Recombinant human KDM5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1375-1482 aa of BC146767 Sequence: SRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL Predict reactive species Full Name: lysine (K)-specific demethylase 5D Calculated Molecular Weight: 1482 aa, 167 kDa Observed Molecular Weight: 70 kDa, 175 kDa GenBank Accession Number: BC146767 Gene Symbol: KDM5D Gene ID (NCBI): 8284 RRID: AB_2879160 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BY66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924