Iright
BRAND / VENDOR: Proteintech

Proteintech, 22765-1-AP, SPRY4 Polyclonal antibody

CATALOG NUMBER: 22765-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPRY4 (22765-1-AP) by Proteintech is a Polyclonal antibody targeting SPRY4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 22765-1-AP targets SPRY4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SPRY4, also named as Protein sprouty homolog 4, is a 299 amino acid protein, which contains one SPR (sprouty) domain and belongs to the sprouty family. SPRY4 Suppresses the INS receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras. SPRY4 has a cellular function to regulate the actin cytoskeleton, independent of its inhibitory activity on the Ras/MAP kinase signalling. SPRY1, SPRY2, SPRY3, SPRY4, are central and complex regulators of the receptor tyrosine kinase (RTK) signalling pathway. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18574 Product name: Recombinant human SPRY4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC125095 Sequence: MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKC Predict reactive species Full Name: sprouty homolog 4 (Drosophila) Calculated Molecular Weight: 299 aa, 33 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC125095 Gene Symbol: SPRY4 Gene ID (NCBI): 81848 RRID: AB_2879163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924