Iright
BRAND / VENDOR: Proteintech

Proteintech, 22770-1-AP, CCDC64B Polyclonal antibody

CATALOG NUMBER: 22770-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC64B (22770-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC64B in WB, IHC, ELISA applications with reactivity to human samples 22770-1-AP targets CCDC64B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCDC64B, also named as BICDL2 and BICDR2, belongs to BICD family. It was officially named by Schlager et al (2010) in a sequence homology search for new mammalian BICD-like proteins. At present, there is still little study on this protein, which may involve the vesicle transport along microtubule, and Golgi to secretory granule transport. BICDR2 has 2 isoforms with the molecular mass of 57 and 34 kDa (PMID:20360680, 20485297). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18720 Product name: Recombinant human CCDC64B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-508 aa of BC128602 Sequence: LQSRRQDLEAQIRGLREEVEKGEGRLQTTHEELLLLRRERREHSLELERARSEAGEALSALRRLRRRVSELEEESRLQDADVSAASLQSELAHSLDDGDQGQGADAPGDTPTTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQSLREELQRQKELRAQEDPGEALHSALSDRDEAVNKALELSLQLNRVSLERDSLSRELLRAIRQKVALTQELEAWQDDMQVVIGQQLRSQRQKELSASASSSTPRRAAPRFSLRLGPGPAGGFLSNLFRRT Predict reactive species Full Name: coiled-coil domain containing 64B Calculated Molecular Weight: 508 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC128602 Gene Symbol: CCDC64B Gene ID (NCBI): 146439 RRID: AB_2918078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1A5D9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924