Iright
BRAND / VENDOR: Proteintech

Proteintech, 22772-1-AP, MIXL1 Polyclonal antibody

CATALOG NUMBER: 22772-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIXL1 (22772-1-AP) by Proteintech is a Polyclonal antibody targeting MIXL1 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 22772-1-AP targets MIXL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat pancreas tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mix1 homeobox-like 1 (MIXL1) Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression. This antibody is specific to MIXL1. Specification Tested Reactivity: human, rat Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18732 Product name: Recombinant human MIXL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-232 aa of BC113441 Sequence: KSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF Predict reactive species Full Name: Mix1 homeobox-like 1 (Xenopus laevis) Calculated Molecular Weight: 232 aa, 25 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC113441 Gene Symbol: MIXL1 Gene ID (NCBI): 83881 RRID: AB_2879164 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9H2W2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924