Proteintech, 22784-1-AP, TWISTNB Polyclonal antibody

Size: 20ul / 150ul The TWISTNB (22784-1-AP) by Proteintech is a Polyclonal antibody targeting TWISTNB in WB, IHC, ELISA applications with reactivity to human samples 22784-1-AP targets TWISTNB in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, THP-1 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18783 Product name: Recombinant human TWISTNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC130298 Sequence: MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKKKKKHQEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEAE Predict reactive species Full Name: TWIST neighbor Calculated Molecular Weight: 338 aa, 37 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC130298 Gene Symbol: TWISTNB Gene ID (NCBI): 221830 RRID: AB_2879167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3B726 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.