Proteintech, 22785-1-AP, CTAG1B Polyclonal antibody

Size: 20ul / 150ul The CTAG1B (22785-1-AP) by Proteintech is a Polyclonal antibody targeting CTAG1B in WB, ELISA applications with reactivity to human samples 22785-1-AP targets CTAG1B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18784 Product name: Recombinant human CTAG1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-128 aa of BC130362 Sequence: GAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTV Predict reactive species Full Name: cancer/testis antigen 1B Calculated Molecular Weight: 180 aa, 18 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC130362 Gene Symbol: CTAG1B Gene ID (NCBI): 1485 RRID: AB_3669404 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P78358 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.