Iright
BRAND / VENDOR: Proteintech

Proteintech, 22802-1-AP, CCS Polyclonal antibody

CATALOG NUMBER: 22802-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCS (22802-1-AP) by Proteintech is a Polyclonal antibody targeting CCS in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 22802-1-AP targets CCS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: HepG2 cells Positive IHC detected in: mouse brain tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Copper chaperone for superoxide dismutase (CCS) is a soluble factor that converts copper into copper-zinc superoxide dismutase ( SOD1 ). CCS and SOD1 interact directly in vivo and in vitro, and this interaction is mediated by homologous domains in each protein. CCS not only interacts with wild-type SOD1 but also interacts with SOD1 containing common missense mutations, resulting in FALS. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18850 Product name: Recombinant human CCS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-274 aa of BC105016 Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL Predict reactive species Full Name: copper chaperone for superoxide dismutase Calculated Molecular Weight: 274 aa, 29 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC105016 Gene Symbol: CCS Gene ID (NCBI): 9973 RRID: AB_2879172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14618 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924