Proteintech, 22842-1-AP, NO66/C14orf169 Polyclonal antibody

Size: 20ul / 150ul The NO66/C14orf169 (22842-1-AP) by Proteintech is a Polyclonal antibody targeting NO66/C14orf169 in WB, IP, ELISA applications with reactivity to human samples 22842-1-AP targets NO66/C14orf169 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, NCCIT cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information NO66, also known as C14orf169 and MAPJD, is a JmjC domain-containing oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. NO66 is highly conserved during evolution and shows a dual localization pattern, present in both the nucleoplasm and nucleolus (PMID: 14742713). It has been reported that NO66 participates in regulation of Osx transcriptional activity and plays an important role in osteoblast differentiation through interaction with Osx (PMID: 19927124; 23620590). Through interaction with MYC protein, NO66 plays a role in pulmonary carcinogenesis (PMID: 17308053). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18721 Product name: Recombinant human C14orf169 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-640 aa of BC011350 Sequence: LRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLAL Predict reactive species Full Name: chromosome 14 open reading frame 169 Calculated Molecular Weight: 641 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC011350 Gene Symbol: NO66 Gene ID (NCBI): 79697 RRID: AB_2879175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9H6W3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.