Proteintech, 23024-1-AP, SCP3 Polyclonal antibody

Size: 20ul / 150ul The SCP3 (23024-1-AP) by Proteintech is a Polyclonal antibody targeting SCP3 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 23024-1-AP targets SCP3 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HepG2 cells, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19330 Product name: Recombinant human SYCP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-236 aa of BC062662 Sequence: GKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF Predict reactive species Full Name: synaptonemal complex protein 3 Calculated Molecular Weight: 236 aa, 28 kDa Observed Molecular Weight: 30 kDa, 33 kDa GenBank Accession Number: BC062662 Gene Symbol: SYCP3 Gene ID (NCBI): 50511 RRID: AB_11232426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZU3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.