Iright
BRAND / VENDOR: Proteintech

Proteintech, 23073-1-AP, SUPT6H Polyclonal antibody

CATALOG NUMBER: 23073-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SUPT6H (23073-1-AP) by Proteintech is a Polyclonal antibody targeting SUPT6H in WB, IHC, IP, ELISA applications with reactivity to human samples 23073-1-AP targets SUPT6H in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SUPT6H (suppressor of Ty6 homolog), also known as SPT6, SPT6H, Tat-CT2 (Tat-cotransactivator 2 protein) or emb-5 in C. elegans, is a 1,726 amino acid protein that is highly conserved from yeast to humans. Expressed ubiquitously, SUPT6H localizes to the nucleus and contains one SH2 domain and one S1 domain. SUPT6H participates in both DRB (5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole)-mediated transcriptional inhibition as well as the enhancement of transcriptional elongation by the RNA polymerase II (Pol II). SUPT6H interacts with the nuclear proteins SPT4 and SPT5, which comprise the DSIF (DRB-sensitivity-inducing factor) complex that binds RNA polymerase II, and directly regulates elongation. Via its C-terminus, SUPT6H can also interact with Histone H3. Due to alternative splicing events, three isoforms exist for SUPT6H. This antibody specifically recognizes the 230kd phosphorylated SUPT6H protein. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19426 Product name: Recombinant human SUPT6H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1618-1726 aa of BC136524 Sequence: TPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR Predict reactive species Full Name: suppressor of Ty 6 homolog (S. cerevisiae) Calculated Molecular Weight: 1726 aa, 199 kDa Observed Molecular Weight: 230 kDa GenBank Accession Number: BC136524 Gene Symbol: SUPT6H Gene ID (NCBI): 6830 RRID: AB_11232593 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7KZ85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924