Product Description
Size: 20ul / 150ul
The Alpha cardiac muscle actin (23082-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples
23082-1-AP targets Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse heart tissue
Positive IHC detected in: human normal colon, human colon tissue, human heart tissue, human skeletal muscle tissue, human small intestine tissue, mouse skeletal muscle tissue, mouse heart tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive FC (Intra) detected in: C2C12 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:200-1:1000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19482 Product name: Recombinant human ACTC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC009978 Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species
Full Name: actin, alpha, cardiac muscle 1
Calculated Molecular Weight: 377 aa, 42 kDa
Observed Molecular Weight: 42-45 kDa
GenBank Accession Number: BC009978
Gene Symbol: ACTC1
Gene ID (NCBI): 70
RRID: AB_2879206
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P68032
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924