Iright
BRAND / VENDOR: Proteintech

Proteintech, 23111-1-AP, ZRANB3 Polyclonal antibody

CATALOG NUMBER: 23111-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZRANB3 (23111-1-AP) by Proteintech is a Polyclonal antibody targeting ZRANB3 in WB, ELISA applications with reactivity to human samples 23111-1-AP targets ZRANB3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ZRANB3, also named Annealing helicase 2 or DNA annealing helicase and endonuclease ZRANB3, is a 1079 amino acid protein, which contains one RanBP2-type zinc finger, one helicase C-terminal domain, one HNH domain and one helicase ATP-binding domain. ZRANB3 localizes in the nucleus and belongs to the SNF2/RAD54 helicase family. ZRANB3 as a DNA annealing helicase and endonuclease is required to maintain genome stability at stalled or collapsed replication forks by facilitating fork restart and limiting inappropriate recombination that could occur during template switching events. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19407 Product name: Recombinant human ZRANB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 728-1079 aa of BC064616 Sequence: LPVYDTLMFCASRNTDRIHIYTKDGKQMSCNFIPLDIKLDLWEDLPASFQLKQYRSLILRFVREWSSLTAMKQRIIRKSGQLFCSPILALEEITKQQTKQNCTKRYITKEDVAVASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGYLQAVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQSLASKHGSDITRFLVKK Predict reactive species Full Name: zinc finger, RAN-binding domain containing 3 Calculated Molecular Weight: 1079 aa, 123 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC064616 Gene Symbol: ZRANB3 Gene ID (NCBI): 84083 RRID: AB_2744527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5FWF4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924