Iright
BRAND / VENDOR: Proteintech

Proteintech, 23161-1-AP, Connexin-50 Polyclonal antibody

CATALOG NUMBER: 23161-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Connexin-50 (23161-1-AP) by Proteintech is a Polyclonal antibody targeting Connexin-50 in WB, ELISA applications with reactivity to human, mouse, rat samples 23161-1-AP targets Connexin-50 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Connexin-50 (Cx50), also known as Gap junction alpha 8 protein (GJA8), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Connexin-50 is expressed in lens fiber cells and is essential for the normal physiological function of the lens (PMID: 11916859). Together with Connexin-46, Connexin-50 forms functional half-gap junction channels in non-junctional membranes. The expected molecular weight of Connexin-50 is 50 kDa, and in some literature, Connexin-50 was detected in lens samples at ~65 kDa (PMID: 31195409; PMID: 29196765). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19572 Product name: Recombinant human GJA8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 233-422 aa of BC146507 Sequence: RSALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSKA Predict reactive species Full Name: gap junction protein, alpha 8, 50kDa Calculated Molecular Weight: 433 aa, 48 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC146507 Gene Symbol: GJA8 Gene ID (NCBI): 2703 RRID: AB_3669410 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P48165 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924