Product Description
Size: 20ul / 150ul
The KCTD8 (23197-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD8 in WB, ELISA applications with reactivity to human samples
23197-1-AP targets KCTD8 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human placenta tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
GABA-B receptors are G protein-coupled receptors for gamma-aminobutyric acid (GABA). KCTD8 appears to function as an auxiliary GABA-B receptor subunit that may influence the biophysical and/or pharmacologic properties of the receptor response.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19555 Product name: Recombinant human KCTD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-473 aa of BC136793 Sequence: CDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL Predict reactive species
Full Name: potassium channel tetramerisation domain containing 8
Calculated Molecular Weight: 473 aa, 52 kDa
Observed Molecular Weight: 52 kDa
GenBank Accession Number: BC136793
Gene Symbol: KCTD8
Gene ID (NCBI): 386617
RRID: AB_3669411
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6ZWB6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924