Iright
BRAND / VENDOR: Proteintech

Proteintech, 23254-1-AP, IDH2 Polyclonal antibody

CATALOG NUMBER: 23254-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IDH2 (23254-1-AP) by Proteintech is a Polyclonal antibody targeting IDH2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 23254-1-AP targets IDH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue, DU 145 cells, Jurkat cells, mouse brain tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved. This antibody is specific to IDH2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19748 Product name: Recombinant human IDH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-452 aa of BC009244 Sequence: FAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial Calculated Molecular Weight: 452 aa, 51 kDa Observed Molecular Weight: 41-47 kDa GenBank Accession Number: BC009244 Gene Symbol: IDH2 Gene ID (NCBI): 3418 RRID: AB_2879241 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924