Proteintech, 23308-1-AP, BCMO1 Polyclonal antibody

Size: 20ul / 150ul The BCMO1 (23308-1-AP) by Proteintech is a Polyclonal antibody targeting BCMO1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23308-1-AP targets BCMO1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse colon tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information BCMO1(Beta,beta-carotene 15,15'-monooxygenase) is also named as BCDO, BCDO1 and belongs to the carotenoid oxygenase family.The human BCMO1 cDNA encodes a 63-kDa protein with homologies to members of a large and diverse family of polyene chain oxidases and carotenoid cleavage enzymes.Although BCMO1 can be detected in several tissues, its expression is most pronounced in intestinal mucosa and liver(PMID:16504037).It catalyzes the central cleavage of β-carotene to all-trans retinal and is the key enzyme in the intestinal metabolism of carotenes to vitamin A. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19732 Product name: Recombinant human BCMO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-547 aa of BC126210 Sequence: FKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFGVTENYVIFLEQPFRLDILKMATAYIRSMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRYVFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT Predict reactive species Full Name: beta-carotene 15,15'-monooxygenase 1 Calculated Molecular Weight: 547 aa, 63 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC126210 Gene Symbol: BCMO1 Gene ID (NCBI): 53630 RRID: AB_2879252 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.