Proteintech, 23337-1-AP, C16orf84 Polyclonal antibody

Size: 20ul / 150ul The C16orf84 (23337-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf84 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 23337-1-AP targets C16orf84 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, mouse spleen tissue, Raji cells Positive IP detected in: HepG2 cells Positive IHC detected in: human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cytoplasmic tRNA 2-thiolation protein 2 (CUT2), also named as C16orf84 or NCS2, is a 515 amino acid protein, which belongs to the CUT2 family. C16orf84 localizes in the cytoplasm and Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). C16orf84 may act by forming a heterodimer with CTU1/ATPBD3 that ligates sulfur from thio-carboxylated URM1 onto the uridine of tRNAs at wobble position. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18428 Product name: Recombinant human C16orf84 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 165-515 aa of BC125269 Sequence: QELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS Predict reactive species Full Name: chromosome 16 open reading frame 84 Calculated Molecular Weight: 515 aa, 56 kDa Observed Molecular Weight: 65-68 kDa GenBank Accession Number: BC125269 Gene Symbol: C16orf84 Gene ID (NCBI): 348180 RRID: AB_2879257 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2VPK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.