Product Description
Size: 20ul / 150ul
The KDELC2 (23345-1-AP) by Proteintech is a Polyclonal antibody targeting KDELC2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
23345-1-AP targets KDELC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, human placenta tissue, SMMC-7721 cells
Positive IHC detected in: human breast cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19929 Product name: Recombinant human KDELC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-343 aa of BC036526 Sequence: VNGTPSPIPIISWCGSLDSRDVVLPTYDITHSMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSLEERLQLVQLSKENPQLLDAGITGY Predict reactive species
Full Name: KDEL (Lys-Asp-Glu-Leu) containing 2
Calculated Molecular Weight: 507 aa, 59 kDa
Observed Molecular Weight: 62 kDa
GenBank Accession Number: BC036526
Gene Symbol: KDELC2
Gene ID (NCBI): 143888
RRID: AB_2879260
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q7Z4H8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924