Proteintech, 23349-1-AP, TMTC1 Polyclonal antibody

Size: 20ul / 150ul The TMTC1 (23349-1-AP) by Proteintech is a Polyclonal antibody targeting TMTC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23349-1-AP targets TMTC1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse bladder tissue, mouse colon tissue, mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19944 Product name: Recombinant human TMTC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 426-774 aa of BC042083 Sequence: KMYYQRALQLHPQHNRALFNLGNLLKSQEKKEEAITLLKDSIKYGPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLVDTGLPEKAVAHYQQAIKLSPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQENHDKALDAIDKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFESYRLAVQLNPDQAQAWMNMGGIQHIKGKYVSARAYYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT Predict reactive species Full Name: transmembrane and tetratricopeptide repeat containing 1 Calculated Molecular Weight: 882 aa, 99 kDa Observed Molecular Weight: 99 kDa, 65 kDa GenBank Accession Number: BC042083 Gene Symbol: TMTC1 Gene ID (NCBI): 83857 RRID: AB_2879261 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.