Proteintech, 23431-1-AP, CEBPB Polyclonal antibody

Size: 20ul / 150ul The CEBPB (23431-1-AP) by Proteintech is a Polyclonal antibody targeting CEBPB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 23431-1-AP targets CEBPB in WB, IHC, IF/ICC, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCAAT/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein.Three variants of CEBPBs have been detected: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20 kDa liver-enriched transcription-inhibitory protein (LIP). (PMID:18820298). This antibody is specific to CEBPB. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), beta Calculated Molecular Weight: 345 aa, 36 kDa Observed Molecular Weight: 42 kDa,46 kDa GenBank Accession Number: BC007538 Gene Symbol: CEBPB Gene ID (NCBI): 1051 RRID: AB_2879278 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17676 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.