Proteintech, 23432-1-AP, TTC39B Polyclonal antibody

Size: 20ul / 150ul The TTC39B (23432-1-AP) by Proteintech is a Polyclonal antibody targeting TTC39B in WB, IHC, ELISA applications with reactivity to human, mouse samples 23432-1-AP targets TTC39B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20081 Product name: Recombinant human TTC39B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC142985 Sequence: MALLGSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGASTVSSSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQTCQKKKYTVVESFSSLLSRGSLEQLSEEEMHA Predict reactive species Full Name: tetratricopeptide repeat domain 39B Calculated Molecular Weight: 682 aa, 77 kDa Observed Molecular Weight: 59 kDa, 67 kDa GenBank Accession Number: BC142985 Gene Symbol: TTC39B Gene ID (NCBI): 158219 RRID: AB_2879279 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VTQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.