Iright
BRAND / VENDOR: Proteintech

Proteintech, 23549-1-AP, KGA/GAM/GAC Polyclonal antibody

CATALOG NUMBER: 23549-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KGA/GAM/GAC (23549-1-AP) by Proteintech is a Polyclonal antibody targeting KGA/GAM/GAC in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 23549-1-AP targets KGA/GAM/GAC in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse brain tissue, mouse liver tissue, rat brain tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human kidney tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GLS, also named as GLS1 and KIAA0838, belongs to the glutaminase family. It catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Glutaminase-, glutamate-, and taurine-immunoreactive neurons develop neurofibrillary tangles in Alzheimer's disease.The glutaminase band in AA/C1 cells is more intense than in HT29 cells, in accordance with measurements of glutaminase activity, and had the same molecular mass of approx. 63 kDa(PMID:12408749). Ping Gao et al. (2009) determined that mitochondrial glutaminase expression (GLS, molecular mass of ~58 kDa) is increased ~10-fold in response to Myc. It also reveals a molecular weight of 83-84 kDa as a phosphate-dependent glutaminase(PMID:447624;7512428). GLS has 3 isoforms produced by alternative splicing and this antibody can recognize all the 3 isoforms(KGA,GAM,GAC) of GLS. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20354 Product name: Recombinant human GLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC038507 Sequence: MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE Predict reactive species Full Name: glutaminase Calculated Molecular Weight: 669 aa, 73 kDa Observed Molecular Weight: 58 kDa, 65 kDa, 83 kDa GenBank Accession Number: BC038507 Gene Symbol: GLS Gene ID (NCBI): 2744 RRID: AB_2879295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94925 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924